Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody orb18543 from Biorbyt

Product Specs
ItemAlpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb18543
HostRabbit
ClonalityPolyclonal
FormatLyophilized
TargetAlpha Amylase 1/AMY1A/AMY1B/AMY1C
Conjugate/TagUnconjugated
ApplicationsIHC, WB
IsotypeRabbit IgG
Quantity10 µg, 100 µg
ReactivityHuman, Mouse, Rat
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids
Molecular Weight57768 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat Western blot, 0.1-0.5µg/ml, Mouse, Rat, Human

Add to Compare List